PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g41277.1.p
Common NameBRADI_4g41277, LOC100829145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 273aa    MW: 29068.6 Da    PI: 8.4918
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g41277.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+  +k +G g+W++ ++  g+ R++k+c++rw +yl
  Bradi4g41277.1.p 14 KGAWTKEEDQRLIAHIKDHGDGCWRSLPKAAGLQRCGKSCRLRWINYL 61
                      79********************************************97 PP

2Myb_DNA-binding49.97.5e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg +T+eEd  ++++++  G++ W++Ia +++ gRt++++k++w+++
  Bradi4g41277.1.p  67 RGHFTEEEDNVIIRLHEAIGNK-WSLIAGKLP-GRTDNEIKNYWNTH 111
                       899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.942961IPR017930Myb domain
SuperFamilySSF466892.48E-2913108IPR009057Homeodomain-like
SMARTSM007179.6E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001679.96E-121661No hitNo description
PROSITE profilePS5129426.45162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2765117IPR009057Homeodomain-like
SMARTSM007172.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.4E-1467111IPR001005SANT/Myb domain
CDDcd001677.53E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIK DHGDGCWRSL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGHF TEEEDNVIIR LHEAIGNKWS LIAGKLPGRT DNEIKNYWNT HVKRKLIAQG  120
IDPLTHLPLN AANPGPPGAA HRRRAFPAPL AGGGSASCSR SRDAAGSSED DDSGSLGNLD  180
LDLNLSISPP CVHYPASSSS SPSPPPPARI AAAMDYDPSL GYYASSGVCV CLDRLGFQGN  240
GEPCSFCNGG ASSSSSSSMR PVASSSGVFR FA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0696561e-125BT069656.1 Zea mays full-length cDNA clone ZM_BFb0205E08 mRNA, complete cds.
GenBankKJ7268021e-125KJ726802.1 Zea mays clone pUT3029 MYB transcription factor (MYB67) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578854.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-82MYB08_ANTMA; Myb-related protein 308
TrEMBLI1ITY50.0I1ITY5_BRADI; Uncharacterized protein
STRINGBRADI4G41277.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-77myb domain protein 4